Business Analyst (Trading), Assistant VP

OVERSEA-CHINESE BANKING CORPORATION LIMITED
SG
On-site

Job Description

Job Description

  • Act as the Trading Domain SME to understand, support and deliver strategic imperatives to meet business objectives and goals. This includes Business-IT roadmap planning and tracking to ensure good progress made in strategic initiatives.
  • Lead solutioning effort and help define end-to-end solutions to meet the desired business objectives and/or gain competitive advantage in the industry.
  • Conduct in-depth analysis of business processes, requirements, market trends and industry best practices to influence the desired outcomes.
  • Collaborate / Work with Product Owners and IT Teams to produce high quality project deliverables and support post-implementation issues.
  • Stay up to date on the latest trends, regulatory changes and technology to continuously monitor the business needs and identify opportunities to innovate / enhance the products and services to clients.

Role Requirement

  • Proven product, business analysis and digital transformation experience in Trading Products & Solutions – Global Equities, Futures & Forex Markets etc.
  • Well-versed in industry developments and trends.
  • Strong analytical skills – able to assimilate information quickly and gain consensus from multiple stakeholders.
  • Strong communication skills (both verbal and written) – able to present complex concepts in a clear and concise manner.
  • · Strong interpersonal skills – able to liaise with stakeholders to provide creative / alternative solutions to address business problems and generate new ideas.
  • Strong team player – able to take ownership and deliver independently in a dynamic and fast-paced environment.
  • Experience in negotiation and conflict resolution.
  • Experience in Agile and Waterfall software development methodologies.
  • Experience driving digital initiatives with Business and Operations as a Scrum Master or Product Owner will be an advantage.
  • Note that this role requires 100% work in office

We seek individuals who possess initiative, drive, and attention to details, who can bring a fresh perspective to our team. If you believe you fit this description, we encourage you to apply. Let's deliver innovative solutions together.

Skills & Requirements

Technical Skills

product analysisbusiness analysisdigital transformationtrading productssolutionsmarket trendsindustry best practicesproject deliverablesagilewaterfallscrum masterproduct ownercommunicationinterpersonalteam playerownershipindependentdynamicfast-pacednegotiationconflict resolutionfinancetrading

Employment Type

FULL TIME

Level

mid

Posted

4/6/2026

Apply Now

You will be redirected to OVERSEA-CHINESE BANKING CORPORATION LIMITED's application portal.